DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG31269

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:273 Identity:76/273 - (27%)
Similarity:123/273 - (45%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 ESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSD--LELSH 309
            :.|::||..|..|..|:  :|:.:..|.:.   .|.|::|:...::||||||.|....  :.::.
  Fly    35 DQRIIGGQAAEDGFAPY--QISLQGISGAH---SCGGAIINETFVLTAAHCVENAFIPWLVVVTG 94

  Fly   310 VRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLRI---NSTNGTFTPICLPFNGPITLGNRLI 371
            ....:|.|...| ::.:.:|.|||.|:..||||||.:   .:.:....||.||. .|:..|:.:|
  Fly    95 TNKYNQPGGRYF-LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL-VPMQPGDEVI 157

  Fly   372 GQIGVAAGWSIGSTE--NNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNH 434
                 ..||  |||.  ..|.:|       ::.:.|..|....|.   |.||.:....:    .|
  Fly   158 -----LTGW--GSTVLWGTSPID-------LQVLYLQYVPHRECK---ALLSNDEDCDV----GH 201

  Fly   435 LCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFG-PTLCGVTTIPGVYTLVSSFS 498
            :|.........|.||||||.:.:|           .::|:|.:| |...||   |.|:..|..:.
  Fly   202 ICTFSRLGEGACHGDSGGPLVSNG-----------YLVGLVNWGWPCATGV---PDVHASVYFYR 252

  Fly   499 DWILRSIAEGSDQ 511
            ||| |::..|:.:
  Fly   253 DWI-RNVMSGNSK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/259 (28%)
Tryp_SPc 252..501 CDD:238113 71/256 (28%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/259 (28%)
Tryp_SPc 38..258 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.