DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG31205

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:282 Identity:68/282 - (24%)
Similarity:103/282 - (36%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LAPFTTTLATPIETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQ--ASAGQFPWLTRIA 268
            |..|..|:.|...||.|      ||:       .|.|||..|.: ...|.  |...:.||:.||.
  Fly     6 LLTFLLTITTLHPTIQA------ASV-------GQECGIFNEKQ-YNSDNIIAEPTEHPWVVRIV 56

  Fly   269 YRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVIVHPNYD 333
            ...:..|. :..|:|.||.|..:|||||||....|: .:..|..|..|.:....:..|.|||:|.
  Fly    57 GVTKDGSN-TLLCTGILIDSRRVVTAAHCVSKDESE-SIYGVVFGDSDSSNINLVSAVTVHPDYS 119

  Fly   334 QPKYANDIALLRINST---NGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSN 395
            ..|:.||:|::.:...   :....|||||....:..|:.......:.||.      ...|.|..:
  Fly   120 PRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGL------EGPSFDRRH 178

  Fly   396 STAGVRFIRLPI----VNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMD 456
            |.......|:.:    :::..|....|...|..                    :|......|...
  Fly   179 SATQRLDKRIKMTYTKIDSKECHEKQARFPEEL--------------------ICGHTERSPLSG 223

  Fly   457 DGTSGVFGTSGRYTIIGIVAFG 478
            ...:...||..::.::||...|
  Fly   224 SALTEASGTPRQFHLLGIAVAG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 54/239 (23%)
Tryp_SPc 252..501 CDD:238113 54/236 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.