DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and spirit

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:300 Identity:92/300 - (30%)
Similarity:137/300 - (45%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ASMPPFAQENTQGCG-INVESR----------LLGGDQASAGQFPWLTRIAYRNRSSSRISFRCS 282
            |..|...:.:.|.|. :|..|:          ::||......:||::..:.:|:....||.:||.
  Fly   100 AVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCG 164

  Fly   283 GSLISSNHIVTAAHCVVNLVSDL---ELSHVRLGSQDGAT-----PFAIEQVIVHPNYDQPKYAN 339
            |:||::|.::|||||     :||   ..|.||||. |..|     ..:|.:||:||:|......|
  Fly   165 GALIANNFVLTAAHC-----ADLGGEPPSQVRLGG-DNLTLTEGEDISIRRVIIHPDYSASTAYN 223

  Fly   340 DIALLRI-NSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGV--- 400
            |||||.: .:......|.|:.....:|  |.|:..||      .|.|          |.||:   
  Fly   224 DIALLELETAAKPELKPTCIWTQKEVT--NTLVTAIG------YGQT----------SFAGLSSA 270

  Fly   401 RFIRLPI--VNTTSCAIAYASLSENFQQPIVITPNHLCAQGMP-MNDVCRGDSGGP-FMDDGTSG 461
            :.:::|:  |:...|...|.  .:...|.::.|  .:||..:. ..|.|:|||||| .|.||..|
  Fly   271 QLLKVPLKSVSNEECQHHYQ--KDQLAQGVLGT--QMCAGDITGERDTCQGDSGGPLLMQDGLLG 331

  Fly   462 VFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
            .        ::||.:.|.. | .:..|.|||.||||.|||
  Fly   332 Y--------VVGITSLGQG-C-ASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 84/277 (30%)
Tryp_SPc 252..501 CDD:238113 84/264 (32%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 85/267 (32%)
Tryp_SPc 132..361 CDD:214473 84/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.