DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG18420

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:119/284 - (41%) Gaps:52/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CG----INVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLV 302
            ||    :.:..|::.|..|.....||:   |:.:.||::  |.|.|:|||...::|||||.:...
  Fly    31 CGTRSPLKLGPRIVNGKVAVRNSSPWM---AFLHTSSNQ--FICGGTLISRRLVLTAAHCFIPNT 90

  Fly   303 SDLELSHVRLGSQDG-----ATPFAIEQVIVHPNYDQPKYANDIALLRINST---NGTFTPICLP 359
            :.:    ||||..:.     .....:.:...|..||...:||||||||:.|.   .....|||:.
  Fly    91 TIV----VRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVVYKANIRPICIM 151

  Fly   360 FNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENF 424
            ::..   ....|..|.|..|...|.||   ||..|:....:...|.|   :..||..        
  Fly   152 WDAS---WKHHIDSIKVLTGTGWGRTE---SMHDSSELRTLDISRQP---SKMCAFG-------- 199

  Fly   425 QQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPG 489
                .:..|..|| |...:::|.||:|||.   |....:..:.|:..:|| |.....|   ..|.
  Fly   200 ----SVLSNQFCA-GNWNSNLCIGDTGGPV---GAMVRYRNAFRFVQVGI-AITNKRC---QRPS 252

  Fly   490 VYTLVSSFSDWILRSI--AEGSDQ 511
            |:|.|.|..::|.|..  ..|:|:
  Fly   253 VFTDVMSHIEFIRRIFLTQNGNDR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 73/259 (28%)
Tryp_SPc 252..501 CDD:238113 72/256 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 73/259 (28%)
Tryp_SPc 43..267 CDD:238113 73/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.