DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG33462

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:120/295 - (40%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 QGCGI--NVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLV 302
            :.|||  |:..|.:   .|...|.||:   ||.....   .|.|||:||:...::||||||.:  
  Fly    27 EDCGIPHNISERSV---NAKLAQNPWM---AYLETPK---GFHCSGTLINHLFVLTAAHCVPD-- 80

  Fly   303 SDLELSHVRLGSQDGAT-----------PFA---IEQVIVHPNYDQPKYANDIALLRIN---STN 350
             || |..||||..:..|           ||.   ::....|..|:.....|||.:||:.   ...
  Fly    81 -DL-LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143

  Fly   351 GTFTPICLPFNGPITLGNRL---IGQIGVAAGWSIGSTENNSSMDPSNSTAGV-RFIRLPIVNTT 411
            ....|||      |...||.   |.|:    .|...:....::   :|:|:.| |.:.:......
  Fly   144 NHIRPIC------IFASNRFQEPIDQL----TWFTTTVWRETA---ANATSKVLRTMNIDRQPKE 195

  Fly   412 SCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGP----FMDDGTSGVFGTSGRYTII 472
            :|:..| ..:..|:|        :|| |..::.:|..|||.|    ...:|       |.||..:
  Fly   196 TCSEIY-GWNMTFEQ--------ICA-GNTLSQLCSTDSGAPQIRKMWHNG-------SDRYVQL 243

  Fly   473 GIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSIAE 507
            ||.:   .:.|.....|:...:.|::|||.|.:.:
  Fly   244 GIAS---RVKGQCQNSGILMDLLSYADWIKRVVRQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/276 (26%)
Tryp_SPc 252..501 CDD:238113 70/273 (26%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/266 (26%)
Tryp_SPc 48..269 CDD:214473 68/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.