DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG30323

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:228 Identity:46/228 - (20%)
Similarity:76/228 - (33%) Gaps:80/228 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 CSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLR 345
            |:|||:|:..:||:..||              .::..:||            :||....::.:: 
  Fly    54 CAGSLLSAWWVVTSGCCV--------------STRPESTP------------NQPSNRKNLRVV- 91

  Fly   346 INSTNGTFTPICLPFNGP--------ITLGNRLI-------------GQIGVAAGWSIGSTENNS 389
                  .|||..|....|        |.|....|             |..|......:...|.||
  Fly    92 ------VFTPKRLKKPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEKELNS 150

  Fly   390 SMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSEN----FQ------QPIVITPNHL--------C 436
            :. ..||....|...:..|..::...|::.:.:|    ||      :.|.|....:        |
  Fly   151 TW-LCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDC 214

  Fly   437 AQGMPM------NDVCRGDSGGP-FMDDGTSGV 462
            ::.:.|      .::|:.|.|.| |.|....||
  Fly   215 SRCLCMTSYTGRGNMCQQDLGSPLFCDHFLYGV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 46/228 (20%)
Tryp_SPc 252..501 CDD:238113 46/228 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 46/228 (20%)
Tryp_SPc 45..272 CDD:214473 46/228 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.