DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG30286

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:295 Identity:77/295 - (26%)
Similarity:118/295 - (40%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 MPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAA 295
            |.|.|.:|.:             .||...:.||:   ||.::|...:   |.|:|::...|:|||
  Fly    29 MSPEALQNEE-------------HQAHISESPWM---AYLHKSGELV---CGGTLVNHRFILTAA 74

  Fly   296 HCVVNLVSDLELSHVRLGSQDGAT--------------PFAIEQVIVHPNYDQPKYANDIALLRI 346
            ||:   ..|..|: ||||..:..|              .|.|:....|..|.:....:||.|||:
  Fly    75 HCI---REDENLT-VRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRL 135

  Fly   347 NST---NGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIV 408
            ..:   .....||||..|..:......:.:: ||.||....:|..:.:        ::.||:..|
  Fly   136 AKSVEYKVHIKPICLITNTTLQPKIERLHRL-VATGWGRSPSEAANHI--------LKSIRVTRV 191

  Fly   409 NTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGR--YTI 471
            |...|:..|.......|    |..:|  ..|:.    |.||||||.     .......||  :..
  Fly   192 NWGVCSKTYWVDRRRDQ----ICVSH--ESGVS----CSGDSGGPM-----GQAIRLDGRVLFVQ 241

  Fly   472 IGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSIA 506
            :|||::|...|   ..|.|:|.|....|||:.:::
  Fly   242 VGIVSYGNAEC---LSPSVFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/270 (26%)
Tryp_SPc 252..501 CDD:238113 71/267 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 72/266 (27%)
Tryp_SPc 39..268 CDD:214473 71/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.