DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG30091

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:294 Identity:76/294 - (25%)
Similarity:124/294 - (42%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 QGCGINVE--SRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCV---- 298
            :.||:.::  .:::||..|...:.||:..|      .:...|.|.||:|::..::|||||:    
  Fly    25 EDCGVPMQLIPKIVGGVDAGELKNPWMALI------KTNDEFICGGSVITNKFVLTAAHCMCTDE 83

  Fly   299 ------VNLVSDLELSHVRLGSQDGATP---FAIEQVIVHPNYDQPKYANDIALLRINST---NG 351
                  ..|...|.:.|: |.:.:...|   :.:|:|.:|.::....|.|||||||:..:   ..
  Fly    84 ECIVKYTQLTVTLGVYHL-LATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKP 147

  Fly   352 TFTPICLPFNGPITLGNRLIGQIGVAAGWSI---GSTENNSSMDPSNSTAGVRFIRLPIVNTTSC 413
            ...|:|:..|..:.....||.:. .|.||.:   |...||..|           :::..::...|
  Fly   148 QIKPLCILLNDQLKPQTDLIQEF-TAIGWGVTGNGKMSNNLQM-----------VKIYRIDRKMC 200

  Fly   414 AIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGP----FMDDGTSGVFGTSGRYTIIGI 474
            ..|:   ...|..|:      .||......|.|:.|||||    .:.||..       |.|.:||
  Fly   201 EAAF---WYTFDYPM------FCAGTAVGRDTCKRDSGGPLYIHMLFDGIK-------RATQLGI 249

  Fly   475 VAFGPTLC-GVTTIPGVYTLVSSFSDWILRSIAE 507
            |:.|...| |.    |:||.|....|:|.|.:.:
  Fly   250 VSTGTEDCRGF----GMYTDVMGHIDFIERIVLD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/275 (26%)
Tryp_SPc 252..501 CDD:238113 72/272 (26%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 72/275 (26%)
Tryp_SPc 37..276 CDD:238113 73/277 (26%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.