DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG30090

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:300 Identity:85/300 - (28%)
Similarity:125/300 - (41%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVES---RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVS 303
            ||:...:   :::||..|.....||:..|      .|.:...|.|:||:...::|||||    |:
  Fly    29 CGLTANTIAFKIIGGRDAIINSNPWMAYI------HSSVKLICGGTLITQRFVLTAAHC----VN 83

  Fly   304 DLELSHVRLGSQDG--------------ATPFAIEQVIVHPNYDQPKYANDIALLRIN---STNG 351
            :.....||||..|.              |....::....|..:.:.|..|||||||:.   :...
  Fly    84 EGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKA 148

  Fly   352 TFTPICLPFNGPITLG---NRLIGQIG--VAAGWSIGSTENNSSMDPSNSTAGV-RFIRLPIVNT 410
            ..:|||      |.||   ..|:..|.  ||.||  |.|.       ::.|.|| :..:|...|:
  Fly   149 HISPIC------IILGTSKRELVDSIEWFVATGW--GETR-------THRTRGVLQITQLQRYNS 198

  Fly   411 TSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGT-----SGRYT 470
            :.|..|...|         :..|.:|| |...:|.|.||||||        :|.|     ..|..
  Fly   199 SQCMQALGRL---------VQQNQICA-GRLGSDTCNGDSGGP--------LFQTVRHMDKMRPV 245

  Fly   471 IIGIVAFGPTLC-GVTTIPGVYTLVSSFSDWILRSIAEGS 509
            ..|:|::|...| |:    ||||.|.|::|||...:.:.:
  Fly   246 QFGVVSYGSRECSGI----GVYTDVYSYADWIATVVQQNT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 81/280 (29%)
Tryp_SPc 252..501 CDD:238113 81/277 (29%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 81/280 (29%)
Tryp_SPc 40..276 CDD:238113 83/282 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.