DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG30087

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:299 Identity:90/299 - (30%)
Similarity:129/299 - (43%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVES----RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVV-NL 301
            ||:..||    |::.|.:|.....|::..:.  |.|.:    .|.||:::|.:|:||||||. ||
  Fly    30 CGVTYESQTAMRVVNGKEAVIRSAPFMVYVT--NNSLT----HCGGSILNSRYILTAAHCVFPNL 88

  Fly   302 VSDLELSHVRLGSQDGAT--------------PFAIEQVIVHPNYDQPKYANDIALLRINST--- 349
                   .:|||..:..|              .:.|.:.|.|..|:...:.||||||::|.:   
  Fly    89 -------RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINF 146

  Fly   350 NGTFTPICL---PFNGPITLGNRLIGQIGVAA----GWSIGSTENNSSMDPSNSTAGVRFIRLPI 407
            |....|||:   |.:.|           .||.    ||  |.|:.|.               .|.
  Fly   147 NVHIQPICILLNPASAP-----------SVATYQTFGW--GETKKNG---------------FPH 183

  Fly   408 VNTTSCAIAY--ASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMD----DGTSGVFGTS 466
            :..|:...||  |..|.:|.  ..:..|.:|| |....|.|.||||||.:.    ||..      
  Fly   184 LLQTAELRAYDAAYCSRSFH--AYMNGNQICA-GHEERDTCAGDSGGPLVTRVDFDGVK------ 239

  Fly   467 GRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSI 505
             ||..:|||::|||.|   ..|||||.|.::.:||.|::
  Fly   240 -RYLQLGIVSYGPTDC---QSPGVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 83/282 (29%)
Tryp_SPc 252..501 CDD:238113 82/279 (29%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 83/282 (29%)
Tryp_SPc 42..272 CDD:238113 84/283 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.