DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and T22A3.6

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:138 Identity:28/138 - (20%)
Similarity:46/138 - (33%) Gaps:44/138 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 NSSMDPSNSTAG------------VRFIRLPIVNTTS--CAIAYASLSENFQ--QPIVITPNHLC 436
            ||:.|.|:|::.            ..|.|.|..|...  |.:...:.:..||  :|...|.:.. 
 Worm   119 NSTFDISDSSSSSYSMNRILPDEYENFCRNPDKNPLGPWCYVGNDTTAPCFQPCRPSTETSSDF- 182

  Fly   437 AQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGV-TTIPGVYTLVSSFSDW 500
                    ||....|.|:.|...|.:...             |.|.|: ..:..:|.     |.:
 Worm   183 --------VCLNRDGFPYTDYDMSDILDL-------------PQLIGIFKDVDLMYE-----SRF 221

  Fly   501 ILRSIAEG 508
            :|.|:.:|
 Worm   222 VLPSLPDG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 25/129 (19%)
Tryp_SPc 252..501 CDD:238113 25/129 (19%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.