DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and try-1

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:296 Identity:93/296 - (31%)
Similarity:136/296 - (45%) Gaps:47/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 IETIPASLSTTTASMPPFAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRIS-FR 280
            ||.:...|.:|...:............:.::.||:||.::|...:||..::.      ||:. .|
 Worm    25 IEKVGCGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLL------SRLGHHR 83

  Fly   281 CSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGS--QDGATPFAIEQVIVHPNYD---QPKYAND 340
            |.||||..|.::|||||..........| ||:|.  ....:|..:..|.:||.|:   ...|  |
 Worm    84 CGGSLIDPNFVLTAAHCFAKDRRPTSYS-VRVGGHRSGSGSPHRVTAVSIHPWYNIGFPSSY--D 145

  Fly   341 IALLRIN---STNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRF 402
            .|::||:   :|:.|..|||||....:.  |||.    |..||  |||...||:    |...:|.
 Worm   146 FAIMRIHPPVNTSTTARPICLPSLPAVE--NRLC----VVTGW--GSTIEGSSL----SAPTLRE 198

  Fly   403 IRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMN--DVCRGDSGGPFMDDGTSGVFGT 465
            |.:|:::|..|    :||.....:  :..|:.||| |....  |.|:||||||.|       ...
 Worm   199 IHVPLLSTLFC----SSLPNYIGR--IHLPSMLCA-GYSYGKIDSCQGDSGGPLM-------CAR 249

  Fly   466 SGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501
            .|.:.:.|:|::| ..|....:||||..|.|.|.||
 Worm   250 DGHWELTGVVSWG-IGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 87/262 (33%)
Tryp_SPc 252..501 CDD:238113 85/259 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 87/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.