DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG43742

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:289 Identity:85/289 - (29%)
Similarity:126/289 - (43%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FAQENTQGCGINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCV 298
            |||...:.|.:.:..|:..|..|...||    ..|..|.|    .|.|.||||...:::||||| 
  Fly    19 FAQLLDENCKVKITYRVANGHTAITSQF----MAALYNNS----EFFCGGSLIHKQYVLTAAHC- 74

  Fly   299 VNLVSDLELSHVRLGSQDGATPFAI--------EQVIVHPNYDQPKYANDIALLRINST---NGT 352
               |.||:...|.||..:.:.|..:        .:||:|||:....:.|||||||:...   ...
  Fly    75 ---VRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAH 136

  Fly   353 FTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAY 417
            ..|||:..:..:|..|:   ....|.||  |.||:.:.   |:..:.:..:|||      .::.|
  Fly   137 IRPICIILDEDVTSNNQ---NNFTAYGW--GKTEHGNI---SDVLSFIDLVRLP------KSMCY 187

  Fly   418 ASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGP----FMDDGTSGVFGTSGRYTIIGIVAFG 478
            .::            |.:|| |....|.|..|||||    |:..|.|       |..:.||.::|
  Fly   188 QNI------------NTICA-GSTSGDTCESDSGGPLIGNFVHRGKS-------RDILFGITSYG 232

  Fly   479 PTLCGVTTIPGVYTLVSSFSDWILRSIAE 507
            ...|  :.:.||||.|:::..||...:.|
  Fly   233 DAEC--SGLFGVYTDVNAYKSWIASVVLE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 78/266 (29%)
Tryp_SPc 252..501 CDD:238113 77/263 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 78/266 (29%)
Tryp_SPc 35..256 CDD:238113 79/268 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.