DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34409 and CG42694

DIOPT Version :9

Sequence 1:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:287 Identity:70/287 - (24%)
Similarity:117/287 - (40%) Gaps:67/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 CGINVESRLLGG-DQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDL 305
            ||..:.::.:.. .|..||   ||..|      |:.....|||||||...:::||.|:     |:
  Fly    27 CGAPISNQSITKLRQPQAG---WLAHI------SNGTHVLCSGSLISKQFVLSAAQCI-----DV 77

  Fly   306 ELSHVRLGSQDGATP-------FAIEQVIVHPNYDQPKYANDIALLRINST---NGTFTPICLPF 360
               |.:|..|.|.:.       :.:..|:: |::...:...||.||:::.:   |....|||:..
  Fly    78 ---HGKLFVQLGVSNATKSPHWYTVSNVVI-PSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIAL 138

  Fly   361 NGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQ 425
            | ..||....|.|....:.| :...:|..:            |.|..::...|.:   :||.|  
  Fly   139 N-TNTLDMVKILQNFTTSAW-LSKNKNPQT------------IVLSQLSRDRCKL---NLSGN-- 184

  Fly   426 QPIVITPNHLCAQGMPMNDVCRGDSGGPFMD---DGTSGVFGTSGRYTIIGIVAF--GPTLCGVT 485
                :||..:||..:..|:.|..|||.....   .|::.|     |..:.||..:  |.:.|   
  Fly   185 ----VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIV-----REMLFGIRGYVNGRSWC--- 237

  Fly   486 TIPGVYTLVSSFSDWILRSIA--EGSD 510
            :.|.:|..|:....||...:.  :|:|
  Fly   238 SEPAIYIDVAECVGWIETVVQQYDGTD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 64/267 (24%)
Tryp_SPc 252..501 CDD:238113 64/264 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 63/255 (25%)
Tryp_SPc 46..253 CDD:214473 61/252 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.