powered by:
Protein Alignment lmgA and AT5G26640
DIOPT Version :9
Sequence 1: | NP_001097122.1 |
Gene: | lmgA / 5740853 |
FlyBaseID: | FBgn0250903 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_850881.1 |
Gene: | AT5G26640 / 832725 |
AraportID: | AT5G26640 |
Length: | 62 |
Species: | Arabidopsis thaliana |
Alignment Length: | 55 |
Identity: | 25/55 - (45%) |
Similarity: | 36/55 - (65%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 WIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMH---CIVKWLNLQ 67
|.|.||.||:|||.|:::||:|.||.|||||...:..:|..|. |:|:..|::
plant 6 WDAQDETCGLCRMPFDASCPDCKLPEDDCPLSKLLGDYCLAMAIALCVVEDGNIK 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5194 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004746 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11210 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.910 |
|
Return to query results.
Submit another query.