DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and AT5G26640

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_850881.1 Gene:AT5G26640 / 832725 AraportID:AT5G26640 Length:62 Species:Arabidopsis thaliana


Alignment Length:55 Identity:25/55 - (45%)
Similarity:36/55 - (65%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMH---CIVKWLNLQ 67
            |.|.||.||:|||.|:::||:|.||.|||||...:..:|..|.   |:|:..|::
plant     6 WDAQDETCGLCRMPFDASCPDCKLPEDDCPLSKLLGDYCLAMAIALCVVEDGNIK 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 25/55 (45%)
AT5G26640NP_850881.1 RING_Ubox 10..>36 CDD:388418 16/25 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004746
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11210
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.