DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and APC11

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001325493.1 Gene:APC11 / 819756 AraportID:AT3G05870 Length:90 Species:Arabidopsis thaliana


Alignment Length:75 Identity:46/75 - (61%)
Similarity:57/75 - (76%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCIVKWLNLQPLNKQ 72
            |..||:|.|.|.||.||||||:|:..||:|.||||||||:||.|:|.||:|||:||:|.|.....
plant    14 WHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAH 78

  Fly    73 CPMCRQSWKF 82
            |||||:.|:|
plant    79 CPMCRREWQF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 45/73 (62%)
APC11NP_001325493.1 RING-H2_APC11 26..88 CDD:319370 39/61 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 135 1.000 Domainoid score I1622
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41136
Inparanoid 1 1.050 135 1.000 Inparanoid score I1838
OMA 1 1.010 - - QHG53620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004746
OrthoInspector 1 1.000 - - oto2819
orthoMCL 1 0.900 - - OOG6_103498
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3902
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.