DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and APC11

DIOPT Version :10

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001325493.1 Gene:APC11 / 819756 AraportID:AT3G05870 Length:90 Species:Arabidopsis thaliana


Alignment Length:75 Identity:46/75 - (61%)
Similarity:57/75 - (76%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCIVKWLNLQPLNKQ 72
            |..||:|.|.|.||.||||||:|:..||:|.||||||||:||.|:|.||:|||:||:|.|.....
plant    14 WHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAH 78

  Fly    73 CPMCRQSWKF 82
            |||||:.|:|
plant    79 CPMCRREWQF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:473075 45/73 (62%)
APC11NP_001325493.1 RING-H2_APC11 26..88 CDD:438120 39/61 (64%)

Return to query results.
Submit another query.