DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and Roc1b

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_652613.1 Gene:Roc1b / 53445 FlyBaseID:FBgn0040291 Length:122 Species:Drosophila melanogaster


Alignment Length:85 Identity:31/85 - (36%)
Similarity:44/85 - (51%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVTIKSWTGVATWRWIANDENCGICRMSFESTCPEC-ALPG---DDCPLVWGVCSHCFHMHCIVK 62
            :..:|.|...|.|.|....:||.|||....:.|.|| |.|.   |:|.:.||.|:|.||.|||.:
  Fly    36 RFVVKKWVAHAMWGWDVAVDNCAICRNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIAR 100

  Fly    63 WLNLQPLNKQCPMCRQSWKF 82
            ||..:.:   ||:..:.|.:
  Fly   101 WLKTRLV---CPLDNKEWVY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 31/83 (37%)
Roc1bNP_652613.1 RING 35..122 CDD:302633 31/85 (36%)
zf-rbx1 36..112 CDD:289448 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463167
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.