Sequence 1: | NP_001097122.1 | Gene: | lmgA / 5740853 | FlyBaseID: | FBgn0250903 | Length: | 85 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002244.1 | Gene: | ANAPC11 / 51529 | HGNCID: | 14452 | Length: | 196 | Species: | Homo sapiens |
Alignment Length: | 51 | Identity: | 31/51 - (60%) |
---|---|---|---|
Similarity: | 35/51 - (68%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKVTIKSWTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVC 51 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lmgA | NP_001097122.1 | RING_Ubox | 1..82 | CDD:418438 | 31/51 (61%) |
ANAPC11 | NP_001002244.1 | RING_Ubox | 1..>51 | CDD:327409 | 30/49 (61%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165150777 | |
Domainoid | 1 | 1.000 | 157 | 1.000 | Domainoid score | I4159 |
eggNOG | 1 | 0.900 | - | - | E1_COG5194 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H41136 | |
Inparanoid | 1 | 1.050 | 157 | 1.000 | Inparanoid score | I4291 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53620 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0004746 | |
OrthoInspector | 1 | 1.000 | - | - | oto91760 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103498 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR11210 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R67 |
SonicParanoid | 1 | 1.000 | - | - | X3902 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
16 | 15.790 |