DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and ANAPC11

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001002244.1 Gene:ANAPC11 / 51529 HGNCID:14452 Length:196 Species:Homo sapiens


Alignment Length:51 Identity:31/51 - (60%)
Similarity:35/51 - (68%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVTIKSWTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVC 51
            |||.||.|.|||||.|:|||||||||||:|...||:|.|.|:......|.|
Human     1 MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWC 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 31/51 (61%)
ANAPC11NP_001002244.1 RING_Ubox 1..>51 CDD:327409 30/49 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150777
Domainoid 1 1.000 157 1.000 Domainoid score I4159
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41136
Inparanoid 1 1.050 157 1.000 Inparanoid score I4291
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004746
OrthoInspector 1 1.000 - - oto91760
orthoMCL 1 0.900 - - OOG6_103498
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R67
SonicParanoid 1 1.000 - - X3902
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.