DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and Anapc11

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001119554.1 Gene:Anapc11 / 498030 RGDID:1561880 Length:84 Species:Rattus norvegicus


Alignment Length:82 Identity:61/82 - (74%)
Similarity:68/82 - (82%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVTIKSWTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCIVKWLN 65
            |||.||.|.|||||.|:|||||||||||:|...||:|.:||||||||||.||||||||||:||||
  Rat     1 MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLN 65

  Fly    66 LQPLNKQCPMCRQSWKF 82
            .|.:.:.||||||.|||
  Rat    66 AQQVQQHCPMCRQEWKF 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 59/80 (74%)
Anapc11NP_001119554.1 RING_Ubox 1..84 CDD:418438 61/82 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344251
Domainoid 1 1.000 159 1.000 Domainoid score I4000
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41136
Inparanoid 1 1.050 159 1.000 Inparanoid score I4165
OMA 1 1.010 - - QHG53620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004746
OrthoInspector 1 1.000 - - oto98827
orthoMCL 1 0.900 - - OOG6_103498
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3902
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.