DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and Roc2

DIOPT Version :10

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_610691.1 Gene:Roc2 / 36246 FlyBaseID:FBgn0044020 Length:113 Species:Drosophila melanogaster


Alignment Length:84 Identity:30/84 - (35%)
Similarity:42/84 - (50%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TIKSWTGVATWRWIANDENCGICRMSFESTCPEC-------ALPGDDCPLVWGVCSHCFHMHCIV 61
            |:|.|..||.|.|....:.|.|||:....:|..|       .:...||.:|||.|:|.||..|:.
  Fly    26 TLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMS 90

  Fly    62 KWLNLQPLNKQCPMCRQSW 80
            .|:.   .|.:||:|:|.|
  Fly    91 LWVK---QNNRCPLCQQEW 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:473075 30/84 (36%)
Roc2NP_610691.1 RING-H2_RBX2 42..106 CDD:438129 22/66 (33%)

Return to query results.
Submit another query.