DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and apc11

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_593423.1 Gene:apc11 / 2543187 PomBaseID:SPAC343.03 Length:94 Species:Schizosaccharomyces pombe


Alignment Length:81 Identity:40/81 - (49%)
Similarity:50/81 - (61%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVTIKSWTGVATWRW-IANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCIVKWL 64
            |||.|..:..:|.|.| ...|:.|||||:.|:..||:|..|||:||:|||.|.|.||.|||..||
pombe     1 MKVKILRYHAIANWTWDTPKDDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHCIQNWL 65

  Fly    65 NLQPLNKQCPMCRQSW 80
            .......||||.||::
pombe    66 ATSGSQGQCPMDRQTF 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 40/81 (49%)
apc11NP_593423.1 zf-ANAPC11 1..85 CDD:289620 40/81 (49%)
zf-rbx1 2..78 CDD:289448 37/75 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I1842
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41136
Inparanoid 1 1.050 99 1.000 Inparanoid score I1667
OMA 1 1.010 - - QHG53620
OrthoFinder 1 1.000 - - FOG0004746
OrthoInspector 1 1.000 - - oto102134
orthoMCL 1 0.900 - - OOG6_103498
Panther 1 1.100 - - LDO PTHR11210
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R67
SonicParanoid 1 1.000 - - X3902
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.