DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lmgA and rbx-2

DIOPT Version :9

Sequence 1:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_491849.1 Gene:rbx-2 / 172344 WormBaseID:WBGene00019993 Length:112 Species:Caenorhabditis elegans


Alignment Length:77 Identity:27/77 - (35%)
Similarity:42/77 - (54%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKSWTGVATWRWIANDENCGICRMSFESTCPEC-ALPGDDCPLVWGVCSHCFHMHCIVKWLNLQP 68
            :|.|..:|.|.|....:.|.|||:.....|..| :.|..:|.:|||.|:|.||..|:.:|:.   
 Worm    32 LKKWNALAVWAWDVECDTCAICRVHLMEECLRCQSEPSAECYVVWGDCNHSFHHCCMTQWIR--- 93

  Fly    69 LNKQCPMCRQSW 80
            .|.:||:|::.|
 Worm    94 QNNRCPLCQKDW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lmgANP_001097122.1 RING_Ubox 1..82 CDD:418438 27/77 (35%)
rbx-2NP_491849.1 RING-H2_RBX2 47..105 CDD:319380 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.