DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCO1

DIOPT Version :10

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:94 Identity:23/94 - (24%)
Similarity:44/94 - (46%) Gaps:16/94 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 SPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNPDNQFKSIPLGLWWAIVTMT 458
            :|.||          :.:..|..:|.:|     :|.:|..:.|.: .::...:...|::.|||||
plant    73 NPNLR----------RVIMFLALYLTIG-----TLCFYLVRDQIS-GHKTSGVVDALYFCIVTMT 121

  Fly   459 TVGYGDVAPKTYPGMFVGALCALAGVLTI 487
            ||||||:.|.:.....:......:|::.:
plant   122 TVGYGDLVPNSSASRLLACAFVFSGMVLV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB_Shaw-like 4..115 CDD:349723
Ion_trans 307..506 CDD:459842 23/94 (24%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:462301 20/76 (26%)
Ion_trans_2 202..277 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.