DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and Kcnv1

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_080476.2 Gene:Kcnv1 / 67498 MGIID:1914748 Length:503 Species:Mus musculus


Alignment Length:539 Identity:137/539 - (25%)
Similarity:216/539 - (40%) Gaps:165/539 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNVSGIRYETYKATLKKIPATRLSRLTEALANY-------------------DPVLNEYFFDRHP 54
            :||.|.|:...:..|...|.|||.:|...:|:|                   :||.|||||||..
Mouse    46 VNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSS 110

  Fly    55 GVFTQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLD 119
            ..|..:|:|||||:||....:|...|.:|:::||:|...::.||...|...::...||..  |.|
Mouse   111 QAFRYVLHYYRTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDF--KKD 173

  Fly   120 IENEKPTEEQIARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVI 184
            .::::...|.       |:..|.|.  | ..::.|:|.:.::|.|||.|:|...:|:.|:.||::
Mouse   174 TDDQESQHES-------EQDFSKGP--C-PTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIV 228

  Fly   185 SFCLKTHPGFRVDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTN 249
            :..|.:                                                           
Mouse   229 NMALMS----------------------------------------------------------- 234

  Fly   250 YTSYSSGNFTASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPH 314
                                                                .:..|:..     
Mouse   235 ----------------------------------------------------AELSWLNL----- 242

  Fly   315 EAFFYVELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFY-------------TDVM 366
            :....:|.||..||..|.::|.:...:...|::...||||..|.|.||             |..:
Mouse   243 QLLEILEYVCISWFTGEFVLRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSGSHTTQEL 307

  Fly   367 QRMGEYTGLLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYY 431
            :.:|.   |::...::|.:|:.||.|||.|||.|..|.....:|:.||:.||.:||..|:::.|:
Mouse   308 ENVGR---LVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIFSTIEYF 369

  Fly   432 AEKLQDNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVS 496
            ||  |..||..|.|:|...|||..:||||||||:.|.|..|..|..:|.|:|:|.:|||:.:|..
Mouse   370 AE--QSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVLALPIAIIND 432

  Fly   497 NFSMFYSHTQARSKLPKKR 515
            .||..|...:.:....::|
Mouse   433 RFSACYFTLKLKEAAVRQR 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 37/108 (34%)
BTB_2 7..97 CDD:280393 36/106 (34%)
Ion_trans 307..506 CDD:278921 74/211 (35%)
Ion_trans_2 <449..499 CDD:285168 23/49 (47%)
Kcnv1NP_080476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
BTB_POZ 44..163 CDD:365784 39/116 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..192 6/29 (21%)
Ion_trans 212..438 CDD:366146 81/346 (23%)
Selectivity filter. /evidence=ECO:0000250 395..400 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.