DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and kcna7

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:XP_701294.4 Gene:kcna7 / 572481 ZFINID:ZDB-GENE-120215-257 Length:233 Species:Danio rerio


Alignment Length:193 Identity:66/193 - (34%)
Similarity:96/193 - (49%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQILNYYRT-GKL 69
            |:.:||||:||||...||.:.|.:.|......|..:||:.||.|.||:...|..||.:|:: |:|
Zfish    68 RLAINVSGMRYETQIRTLAQFPDSLLGDPRRRLRYFDPLRNEIFLDRNRFCFDAILYFYQSGGRL 132

  Fly    70 HYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQIARLF 134
            ..|.:|...:|.:||.|:.|..:                     |:.:...:...|.||      
Zfish   133 RRPANVPLDVFMDELRFYELGED---------------------IMARFKEDEGFPKEE------ 170

  Fly   135 GFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGFRVD 197
              ...|...|   :||   |||.:|:.|.||.||:|:|.:||..|.||::.|||:|.|.|||:
Zfish   171 --PRPLPESE---FQR---KIWMLFEHPESSGGARIIAIISVMVIVVSILIFCLETLPDFRVE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 33/92 (36%)
BTB_2 7..97 CDD:280393 33/90 (37%)
Ion_trans 307..506 CDD:278921
Ion_trans_2 <449..499 CDD:285168
kcna7XP_701294.4 BTB_2 71..160 CDD:280393 34/109 (31%)
BTB 71..158 CDD:197585 34/107 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.