DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCNQ5

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_001153605.1 Gene:KCNQ5 / 56479 HGNCID:6299 Length:951 Species:Homo sapiens


Alignment Length:282 Identity:72/282 - (25%)
Similarity:116/282 - (41%) Gaps:55/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 QRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFY--------------------- 319
            |..:||:....:..::...:     .|..||...|    .||.:                     
Human   100 QSCRRNVKYRRVQNYLYNVL-----ERPRGWAFIY----HAFVFLLVFGCLILSVFSTIPEHTKL 155

  Fly   320 -------VELVCNVWFFIEVIIRLIVSPNL------WQ----FIKSPVNIID---FTATLSFYTD 364
                   :|.|..|.|.:|.||| |.|...      ||    |.:.|..:||   ..|:::..:.
Human   156 ASSCLLILEFVMIVVFGLEFIIR-IWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSA 219

  Fly   365 VMQRMGEYTGLLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLA 429
            ..|.....|..|.:...::|:|:.::.|.....::|.....|.:|||....:...|.::|.:.|.
Human   220 KTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLV 284

  Fly   430 YYAEKLQDNPDNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVI 494
            |..||   :.:.:|.:....|||..:|:||:||||..|.|:.|..:.|..||.|:...|||..::
Human   285 YLVEK---DANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGIL 346

  Fly   495 VSNFSMFYSHTQARSKLPKKRR 516
            .|.|::.... |.|.|..:|||
Human   347 GSGFALKVQE-QHRQKHFEKRR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585
BTB_2 7..97 CDD:280393
Ion_trans 307..506 CDD:278921 60/239 (25%)
Ion_trans_2 <449..499 CDD:285168 21/49 (43%)
KCNQ5NP_001153605.1 Ion_trans 160..358 CDD:278921 57/202 (28%)
Ion_trans_2 274..348 CDD:285168 27/76 (36%)
Selectivity filter. /evidence=ECO:0000250 311..316 3/4 (75%)
KCNQ_channel 472..659 CDD:281513
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..697
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 895..938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.