DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCTD9

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_060104.2 Gene:KCTD9 / 54793 HGNCID:22401 Length:389 Species:Homo sapiens


Alignment Length:130 Identity:35/130 - (26%)
Similarity:57/130 - (43%) Gaps:32/130 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IILNVSGIRYETYKATL-KKIPATRLSRLTE---ALANYDPVLNEYFFDRHPGVFTQILNYYRTG 67
            :.|||.|..:.|.::|| .|.|.:.|:.:.:   ...|.......:..||.|..|..||||.|.|
Human    91 LTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHG 155

  Fly    68 KL--HYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLD--IENEKPTEE 128
            :|  :...::.|.|  ||..|:|:||                      :::.|:  |:|.:|.|:
Human   156 QLIVNDGINLLGVL--EEARFFGIDS----------------------LIEHLEVAIKNSQPPED 196

  Fly   129  128
            Human   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 30/97 (31%)
BTB_2 7..97 CDD:280393 30/95 (32%)
Ion_trans 307..506 CDD:278921
Ion_trans_2 <449..499 CDD:285168
KCTD9NP_060104.2 KHA 2..66 CDD:340593
BTB_POZ_KCTD9 89..188 CDD:349677 31/120 (26%)
YjbI 168..378 CDD:224276 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.