DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCNK10

DIOPT Version :10

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:138 Identity:31/138 - (22%)
Similarity:56/138 - (40%) Gaps:41/138 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 MGEYTGLLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAE 433
            :|:..|.:...||.|:.::|:..:.|.....:|.|           :.|::.|.:.|.::     
Human   207 IGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVIST-----------ILFILAGCIVFVTI----- 255

  Fly   434 KLQDNPDNQFKSIP-----LGLWWAIVTMTTVGYGDVA--------------PKTYPGMFVGALC 479
                 |...||.|.     ..:::.:||:||||:||..              |..:..:.|| |.
Human   256 -----PAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVG-LA 314

  Fly   480 ALAGVLTI 487
            ..|.||::
Human   315 YFAAVLSM 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB_Shaw-like 4..115 CDD:349723
Ion_trans 307..506 CDD:459842 31/138 (22%)
KCNK10NP_612190.1 Ion_trans_2 <153..211 CDD:462301 1/3 (33%)
Ion_trans_2 249..328 CDD:462301 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.