DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCNA3

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_002223.3 Gene:KCNA3 / 3738 HGNCID:6221 Length:575 Species:Homo sapiens


Alignment Length:510 Identity:168/510 - (32%)
Similarity:246/510 - (48%) Gaps:135/510 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GENRIILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQILNYYRT- 66
            || |:::|:||:|:||...||.:.|.|.|......:..:||:.|||||||:...|..||.||:: 
Human   103 GE-RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSG 166

  Fly    67 GKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQIA 131
            |::..|.:|...:|.||:.|:.|....:|.        .|:.:..|.       |.|:|...:  
Human   167 GRIRRPVNVPIDIFSEEIRFYQLGEEAMEK--------FREDEGFLR-------EEERPLPRR-- 214

  Fly   132 RLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGFRV 196
                           .:||   ::|.:|:.|.||..|:.:|.:||..|.:|::.|||:|.|.|| 
Human   215 ---------------DFQR---QVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFR- 260

  Fly   197 DLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNYTSYSSGNFTAS 261
                                 |....|..|                           |..:|.|:
Human   261 ---------------------DEKDYPAST---------------------------SQDSFEAA 277

  Fly   262 GQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFYVELVCNV 326
            |.:|                 :||                  .....::..|   ||.||.:|.:
Human   278 GNST-----------------SGS------------------RAGASSFSDP---FFVVETLCII 304

  Fly   327 WFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFY----TDVMQRMGE-----YTGLLEAFSIV 382
            ||..|:::|....|:...|.::.:|:||..|.:.::    |::.:|.|.     ...:|....:|
Human   305 WFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLV 369

  Fly   383 RIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNPDNQFKSIP 447
            |:.|:|||:|||.||:||..|.|||.:||.||:|||.:|::.|:|..|:||  .|:|.:.|.|||
Human   370 RVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE--ADDPTSGFSSIP 432

  Fly   448 LGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFY 502
            ...|||:||||||||||:.|.|..|..||:|||:|||||||||||||||||:.||
Human   433 DAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 34/92 (37%)
BTB_2 7..97 CDD:280393 34/90 (38%)
Ion_trans 307..506 CDD:278921 96/205 (47%)
Ion_trans_2 <449..499 CDD:285168 37/49 (76%)
KCNA3NP_002223.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
BTB 106..200 CDD:197585 35/101 (35%)
BTB_2 106..197 CDD:280393 34/98 (35%)
Ion_trans 290..490 CDD:278921 96/203 (47%)
Ion_trans_2 404..481 CDD:285168 48/78 (62%)
Selectivity filter. /evidence=ECO:0000250 444..449 4/4 (100%)
PDZ-binding. /evidence=ECO:0000250 573..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.