DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and KCNV2

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_598004.1 Gene:KCNV2 / 169522 HGNCID:19698 Length:545 Species:Homo sapiens


Alignment Length:545 Identity:136/545 - (24%)
Similarity:225/545 - (41%) Gaps:144/545 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNVSGIRYETYKATLKKIPATRLSRLTEALA---------NYDPVLNEYFFDRHPGVFTQILNYY 64
            :||.|..|:.....|...|.|||.||..:.:         :|:...:||||||.|.||..:.|:|
Human   101 VNVGGHSYQLDYCELAGFPKTRLGRLATSTSRSRQLSLCDDYEEQTDEYFFDRDPAVFQLVYNFY 165

  Fly    65 RTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTYSIHRDTQNTLAILDKLDIENEKPTEEQ 129
            .:|.|.....:|...|.|||.:||:.......||...:...||     .:.::|.|::|...:.|
Human   166 LSGVLLVLDGLCPRRFLEELGYWGVRLKYTPRCCRICFEERRD-----ELSERLKIQHELRAQAQ 225

  Fly   130 IARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKTHPGF 194
            :...   ||...  ::..:...:.::|.:.::|.||..||.:...|..|:.|||::..|.|    
Human   226 VEEA---EELFR--DMRFYGPQRRRLWNLMEKPFSSVAAKAIGVASSTFVLVSVVALALNT---- 281

  Fly   195 RVDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNYTSYSSGNFT 259
                                           ..:..|||   ..|..||..|             
Human   282 -------------------------------VEEMQQHS---GQGEGGPDLR------------- 299

  Fly   260 ASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHEAFFYVELVC 324
                                              .||.|                     ||::|
Human   300 ----------------------------------PILEH---------------------VEMLC 309

  Fly   325 NVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTDVM---------QR------MGEYTG 374
            ..:|.:|.::||..:|:|.:|.:|.:|::|..|.|..|..::         ||      :|:...
Human   310 MGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQLLLECFTGEGHQRGQTVGSVGKVGQ 374

  Fly   375 LLEAFSIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNP 439
            :|....::||.|:.||.|||.|||....|.:...:::..|:.|:.:||..|::..|..|  .|.|
Human   375 VLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAMGIFTFSAAVYSVE--HDVP 437

  Fly   440 DNQFKSIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSH 504
            ...|.:||...|||.|:::||||||:.|:|:.|.|...||...|::...:|:.::.:.||.:||.
Human   438 STNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAFGIILNGMPISILYNKFSDYYSK 502

  Fly   505 TQA--RSKLPKKRRRVLPVEQPRRK 527
            .:|  .:.:.::|..|..:::.|:|
Human   503 LKAYEYTTIRRERGEVNFMQRARKK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 33/98 (34%)
BTB_2 7..97 CDD:280393 32/96 (33%)
Ion_trans 307..506 CDD:278921 66/213 (31%)
Ion_trans_2 <449..499 CDD:285168 18/49 (37%)
KCNV2NP_598004.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..93
BTB 99..190 CDD:321966 31/88 (35%)
Ion_trans 266..504 CDD:306908 83/345 (24%)
Selectivity filter. /evidence=ECO:0000250 457..462 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D818306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.