DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and LOC100360841

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:XP_002730083.1 Gene:LOC100360841 / 100360841 RGDID:2321317 Length:97 Species:Rattus norvegicus


Alignment Length:83 Identity:18/83 - (21%)
Similarity:25/83 - (30%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 VTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVL 519
            :|..|..:|....||:      .||...|            |........|..:...|.||:|..
  Rat     1 MTKGTSSFGKRRNKTH------TLCRRCG------------SKAYHLQKSTCGKCGYPAKRKRKY 47

  Fly   520 PVEQPRRKREPTAPHRGR 537
            ......::|..|...|.|
  Rat    48 NWSAKAKRRNTTGTGRMR 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585
BTB_2 7..97 CDD:280393
Ion_trans 307..506 CDD:278921 9/50 (18%)
Ion_trans_2 <449..499 CDD:285168 9/43 (21%)
LOC100360841XP_002730083.1 PTZ00073 1..88 CDD:240257 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.