DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shawl and kcnd1

DIOPT Version :9

Sequence 1:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_001119942.1 Gene:kcnd1 / 100001681 ZFINID:ZDB-GENE-081105-40 Length:632 Species:Danio rerio


Alignment Length:559 Identity:169/559 - (30%)
Similarity:243/559 - (43%) Gaps:150/559 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDGENR----IILNVSGIRYETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFTQIL 61
            :|.:||    :.:||||:|::|:|.||.:.|.|.|.. :|....|:....||||||.|.:|..||
Zfish    32 IDKKNRNDEILFVNVSGLRFQTWKNTLDRYPDTLLGS-SEKEFFYNEDTQEYFFDRDPEMFRHIL 95

  Fly    62 NYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWSTY-SIHRDTQNTLAILDKLDIENEKP 125
            |:||||:||||...|...|:|||.|:|:..:.:..||...| ...::.|..||:    |.|.|..
Zfish    96 NFYRTGRLHYPRQECIQAFDEELAFYGIVPDIIGDCCMEEYRDRKKENQERLAV----DTEAEMA 156

  Fly   126 TEEQIARLFGFEEALSNGELNCWQRIKPKIWAMFDEPSSSTGAKIVAGMSVFFIFVSVISFCLKT 190
            |:..:.......|               ::|..|:.|.:||.|.:...::.|||.||||:..::|
Zfish   157 TDTPLPPHSTHRE---------------RLWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVET 206

  Fly   191 HP-----GFRVDLPSGAHDAHGPGAGGPPHGHDPMGEPPQTHQYHQHSITPPSGSIGPTFRVTNY 250
            .|     |.:.|||.|                                                 
Zfish   207 VPCRPLKGSKKDLPCG------------------------------------------------- 222

  Fly   251 TSYSSGNFTASGQATPIATIKGGQRQRLKRNINGSILNEFIEEKILGHNGRRKHGWIETYGQPHE 315
                                                                     |.|..   
Zfish   223 ---------------------------------------------------------EKYSL--- 227

  Fly   316 AFFYVELVCNVWFFIEVIIRLIVSPNLWQFIKSPVNIIDFTATLSFYTD-VMQRMGEYTGLLEAF 379
            |||.::..|.:.|..|.::||..:|:..:|::|.:::||..|.:.:|.. ||....:.:|.....
Zfish   228 AFFCMDTACVLIFTFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTL 292

  Fly   380 SIVRIMRLFKLTRHSPGLRILIHTFKASAKELTLLVFFLVLGIVFFASLAYYAEKLQDNPDNQFK 444
            .:.|:.|:||.:|||.|||||.:|.|:.|.||..|:|.|.:.|:.||::.:||||  ......|.
Zfish   293 RVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEK--GTKGTNFT 355

  Fly   445 SIPLGLWWAIVTMTTVGYGDVAPKTYPGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQARS 509
            |||...|:.||||||:||||:.|.|..|...|::|:|:|||.|||||||||||||..|...|...
Zfish   356 SIPASFWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD 420

  Fly   510 KLPKKRRRVLPVEQPRRKREPTAPHRGRTNAIKQTPPTG 548
            |        :..:|..|........:|.|||..|....|
Zfish   421 K--------MRAQQKVRLARIRLAKKGTTNAFLQYKEEG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawlNP_001097131.2 BTB 7..99 CDD:197585 41/91 (45%)
BTB_2 7..97 CDD:280393 40/89 (45%)
Ion_trans 307..506 CDD:278921 85/199 (43%)
Ion_trans_2 <449..499 CDD:285168 31/49 (63%)
kcnd1NP_001119942.1 Shal-type 3..28 CDD:288455
BTB_2 42..131 CDD:280393 40/89 (45%)
BTB 44..132 CDD:197585 40/88 (45%)
Ion_trans 217..415 CDD:278921 89/308 (29%)
Ion_trans_2 331..411 CDD:285168 44/81 (54%)
DUF3399 445..542 CDD:288712 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.