DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34425 and Cfap53

DIOPT Version :9

Sequence 1:NP_001097683.1 Gene:CG34425 / 5740837 FlyBaseID:FBgn0085454 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_344701.3 Gene:Cfap53 / 364899 RGDID:1306734 Length:542 Species:Rattus norvegicus


Alignment Length:476 Identity:108/476 - (22%)
Similarity:218/476 - (45%) Gaps:46/476 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DHFN--FITRTDRKSLHTQIGLLVNKAKEVTAAELHERSKRLKNMLDEEDKRYEEEFSN---TVK 68
            |..|  :|..::|||..|.:...|..|.:.......||..:|:.:|..|:..|..|..:   |::
  Rat    88 DRLNRDWIQHSNRKSFDTLVKARVKDAMQGFVINTEERRNKLRELLASEENEYFSEMQSKGETIE 152

  Fly    69 NRIDQDIKERKEHLHAIKEQVAKQQKKFLEEKHIQQVMLDCYEIREALRHQDLVETKIVQEE--Q 131
            .:.|: ::||.:.|...||   |:::.|:.||..||....|.|:|..|  ..:.|.|:::|.  |
  Rat   153 EKKDK-MRERTKLLREKKE---KERQDFVAEKLDQQFRERCEELRTQL--VSIHEKKVIEERNVQ 211

  Fly   132 ILENQRKKRRECQQDNYWLELNRRRWAQFDCNQAEENQRRHQMQQQVNHVLAVQVAEHEEKRKAA 196
            :..|:..||::..::..:.:|........:..:|::.:|:.::.:.....|..||...:.:|:||
  Rat   212 VEFNKELKRQKLVEEQLFAKLWEEDRLAKERREAQDEKRQRELVENTRLGLDAQVTSIQAQREAA 276

  Fly   197 LAERMEDERLINSLLEEIRLEEFEKEHQAAPVDQLAYQDELLKEIERKRCARLAEWEAE-KANHV 260
            ...:.|:.|::.....:::.|:.:::.|.....| ..::.|.|.::.|..:...|:..: ..|..
  Rat   277 RRMKEEEARVLEQYKAQVKREDEQEKLQKQKTRQ-ETRNSLKKAVQEKMESMQQEYREDLDLNMK 340

  Fly   261 AFCRETQRLEAEALANIAQSKKDLNRATLEYLAYLRRMQSLELGIEKMMDERIADLYQLDMCTKV 325
            ...|..|.|:.|| ....|.::|:.|....|..||.:.:..|...|:.:|..:.|:.......| 
  Rat   341 LVGRALQDLQDEA-DKKKQKREDMGREQKIYNDYLVQRRKEEKAQEQELDRLLEDIKAKKQAEK- 403

  Fly   326 NITERVRVKREAAEK-CHEIL--RK-QICEDYERKIRSDAE--LRENKMMEN-RFVHPEVTHEMI 383
              .:.:.:::||..: .:|::  || |:.|..:||::...|  |.|.::.|: :.:|.|...:..
  Rat   404 --DQELALEKEARRQLLNEVMCTRKLQVQEKLQRKLKEQEELALHEQRINESLKVLHEEDMKDFA 466

  Fly   384 -AC-------RQIQHKADLDAQIKEMKRIQEEEEKRFDSRLMAAVDDPVLCKRLAKEILDNGVDY 440
             .|       .|::.:.....|.:|.::  |||.:.|::.|.|   :.|...::.|.:.::.|..
  Rat   467 RRCALAEEYRNQLRMQIAYQQQAREAEK--EEERQEFEAGLAA---NQVYADKIQKILAEHQVLS 526

  Fly   441 LAPHPNWRVMACNPNKYIPRP 461
            ...||..|.       |:.:|
  Rat   527 QNVHPMRRA-------YLDKP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34425NP_001097683.1 PTZ00121 <29..402 CDD:173412 87/393 (22%)
Cfap53XP_344701.3 TPH 189..518 CDD:290579 72/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52256
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31183
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.