DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34425 and CFAP53

DIOPT Version :9

Sequence 1:NP_001097683.1 Gene:CG34425 / 5740837 FlyBaseID:FBgn0085454 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_659457.2 Gene:CFAP53 / 220136 HGNCID:26530 Length:514 Species:Homo sapiens


Alignment Length:472 Identity:108/472 - (22%)
Similarity:206/472 - (43%) Gaps:58/472 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DRKSLHTQIGLLVNKAKEVTAAELHERSKRLKNMLDEEDKRYEEEFSNTVKNRIDQDIKER-KEH 81
            |.|.|.:.:...:..|.:.....:.||..:|:.:|..|:..|..|..  :|....::.|:| :|.
Human    71 DCKILDSLVRARIKDAVQGFIINIEERRNKLRELLALEENEYFTEMQ--LKKETIEEKKDRMREK 133

  Fly    82 LHAIKEQVAKQQKKFLEEKHIQQVMLDCYEIREALR--HQDLVETKIVQEE--QILENQRKKRRE 142
            ...:||:..|:::.|:.||..||....|.|:|..|.  ||    .|:.:|.  ||..|:...|::
Human   134 TKLLKEKNEKERQDFVAEKLDQQFRERCEELRVELLSIHQ----KKVCEERKAQIAFNEELSRQK 194

  Fly   143 CQQDNYWLELNRRRWAQFDCNQAEENQRRHQMQQQVNHVLAVQVAEHEEKRKAALAERMEDERLI 207
            ..::..:.:|........:..:|:|.:|:.::.:.....|..|:...:.:|:|....:.|:.||:
Human   195 LVEEQMFSKLWEEDRLAKEKREAQEARRQKELMENTRLGLNAQITSIKAQRQATQLLKEEEARLV 259

  Fly   208 NSLLEEIRLE---EFEKEHQAAPVDQLAYQDELLKEIERKRCARLAEWEAEK-ANHVAFCRETQR 268
            .|...:|:.|   :..|:.:|....:...|..|.:.||..:    .|:..|: .|.....|..|.
Human   260 ESNNAQIKHENEQDMLKKQKAKQETRTILQKALQERIEHIQ----QEYRDEQDLNMKLVQRALQD 320

  Fly   269 LEAEALANIAQSKKDLNRATLEYLAYLRRMQSLELGIEKMMDERIADLYQLDMCTKVNITER-VR 332
            |:.|| ....|.::|:.|....|..||.:.:..|...||..|.    :.:.|...|:...:: :|
Human   321 LQEEA-DKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDR----ILEEDKAKKLAEKDKELR 380

  Fly   333 VKREAAEKCHEILRKQICED--------YERKIRSDAELRENKMMENRFVHPEVTH------EMI 383
            :::||        |:|:.::        .:.|::.:|:.:|.:.||.:.::..:..      |..
Human   381 LEKEA--------RRQLVDEVMCTRKLQVQEKLQREAKEQEERAMEQKHINESLKELNCEEKENF 437

  Fly   384 ACRQ---IQHKADLDAQIKEMKRIQEEEEKRFDSRLMAAVDDPVLCKRLAKEILDNGVDYLAP-- 443
            |.||   .:::..|..||...::.||.|::.......|.|....:|....:|:|  ....:.|  
Human   438 ARRQRLAQEYRKQLQMQIAYQQQSQEAEKEEKRREFEAGVAANKMCLDKVQEVL--STHQVLPQN 500

  Fly   444 -HPNWRVMACNPNKYIP 459
             ||..:  || |:|..|
Human   501 IHPMRK--AC-PSKLPP 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34425NP_001097683.1 PTZ00121 <29..402 CDD:173412 89/399 (22%)
CFAP53NP_659457.2 TOP4c <54..171 CDD:238111 27/101 (27%)
TPH 130..451 CDD:290579 75/341 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52256
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31183
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.