DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40635 and ckb1

DIOPT Version :10

Sequence 1:NP_001104166.2 Gene:CG40635 / 5740827 FlyBaseID:FBgn0085506 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001342935.1 Gene:ckb1 / 2542564 PomBaseID:SPAC1851.03 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:36/82 - (43%)
Similarity:50/82 - (60%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WISSFLGIKGNEFLCRVPIDYIQDPFNRTGLE----LFPQTLDVFLNLVF----DRSTDWVSGDE 71
            |:..|||:|||||.|.|..|:|||.||.|||.    .:.|:||:.|:::.    :...|.|....
pombe    16 WVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPDLPEEVQDEVEASA 80

  Fly    72 EKLYGMIHARYIVSKRG 88
            ..|||:||||||::.:|
pombe    81 RHLYGLIHARYILTAQG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40635NP_001104166.2 CK_II_beta 14..>88 CDD:460114 35/80 (44%)
ckb1NP_001342935.1 SKB2 16..231 CDD:227374 36/82 (44%)

Return to query results.
Submit another query.