powered by:
Protein Alignment CG34189 and F53C11.9
DIOPT Version :9
Sequence 1: | NP_001097347.1 |
Gene: | CG34189 / 5740826 |
FlyBaseID: | FBgn0085218 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076745.1 |
Gene: | F53C11.9 / 4927055 |
WormBaseID: | WBGene00044921 |
Length: | 80 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 19/55 - (34%) |
Similarity: | 24/55 - (43%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CGENATMVRCAGVCPETCAFKSLKCPKYCGVNCVCKPDYVFNENLQLCILKTDCP 107
||||.....|...|..||...:..|.:.|...|.||..:|.:.|.:.||....||
Worm 23 CGENEIFNDCGSPCDRTCENPNPMCIQMCKARCECKQGFVVDSNTKKCIDLKKCP 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34189 | NP_001097347.1 |
TIL |
53..106 |
CDD:280072 |
17/52 (33%) |
F53C11.9 | NP_001076745.1 |
TIL |
23..76 |
CDD:366828 |
17/52 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.880 |
|
Return to query results.
Submit another query.