DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34189 and Acp62F

DIOPT Version :9

Sequence 1:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_523892.1 Gene:Acp62F / 38340 FlyBaseID:FBgn0020509 Length:115 Species:Drosophila melanogaster


Alignment Length:110 Identity:35/110 - (31%)
Similarity:46/110 - (41%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VWFNSLCFLLLPALLMDSVMTTGIDEDHILNHDVDPDPGRMKYIWNPFSGFCGENATMVRCAGVC 66
            :|...:|..|...||...:.:.|                     |......|..|.|...|...|
  Fly     4 MWSLKICACLGLLLLFKPIDSMG---------------------WQGPKVDCTANGTQTECPVAC 47

  Fly    67 PETCAFK-SLKCPKYCGVNCVCKPDYVFNENLQLCILKTDCPLDI 110
            ||||.:. :..|.|.||..|||||.||.||.:..|:|::|||.|:
  Fly    48 PETCEYSGNGPCVKMCGAPCVCKPGYVINERIPACVLRSDCPKDV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34189NP_001097347.1 TIL 53..106 CDD:280072 24/53 (45%)
Acp62FNP_523892.1 TIL 34..88 CDD:280072 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138202at33392
OrthoFinder 1 1.000 - - FOG0014389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.