powered by:
Protein Alignment CG34189 and F36H9.4
DIOPT Version :9
Sequence 1: | NP_001097347.1 |
Gene: | CG34189 / 5740826 |
FlyBaseID: | FBgn0085218 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_872222.2 |
Gene: | F36H9.4 / 353436 |
WormBaseID: | WBGene00018112 |
Length: | 78 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 24/56 - (42%) |
Gaps: | 3/56 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CGENATMVRCAGVCPETCAFKSLK-CPKYCGVN-CVCKPDYVFNENLQLCILKTDC 106
||.|.....|...|...||...:. |...|.|| |.||..:..|:: :.|:.:..|
Worm 24 CGPNEDFKECGTACEANCAEGHVMFCTMQCIVNVCQCKDGFFRNKD-KKCVPRNKC 78
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34189 | NP_001097347.1 |
TIL |
53..106 |
CDD:280072 |
16/54 (30%) |
F36H9.4 | NP_872222.2 |
TIL |
24..78 |
CDD:366828 |
16/54 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.970 |
|
Return to query results.
Submit another query.