DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34189 and CG45546

DIOPT Version :10

Sequence 1:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001287583.1 Gene:CG45546 / 19835889 FlyBaseID:FBgn0267106 Length:93 Species:Drosophila melanogaster


Alignment Length:55 Identity:14/55 - (25%)
Similarity:23/55 - (41%) Gaps:4/55 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGENATMVRCAGVCPETCAFK-SLKCPKYCGVNCVCKPDYVFNENLQLCILKTDC 106
            |.....:..|.. |..:|..: :|.|.|.|...|:||..::...:  .||..:.|
  Fly    37 CSSKEIVSPCRS-CERSCGQRETLDCVKDCRYGCICKMGWIRRNS--TCIPMSQC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34189NP_001097347.1 TIL 53..106 CDD:460351 13/53 (25%)
CG45546NP_001287583.1 TIL 37..88 CDD:410995 13/53 (25%)

Return to query results.
Submit another query.