DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34189 and C53B7.2

DIOPT Version :10

Sequence 1:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:55 Identity:18/55 - (32%)
Similarity:26/55 - (47%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGENATMVRCAGVCPETCAFKSLKCPKYC-GVNCVCKPDYVFNENLQLCILKTDC 106
            ||.|.....|..:||.||...:.:|...| ..:|.|.|.:|::.:.| ||....|
 Worm    29 CGINEQYSPCTQMCPPTCESPNPQCRVDCTRPSCTCLPGHVYSNSRQ-CIPANSC 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34189NP_001097347.1 TIL 53..106 CDD:460351 17/53 (32%)
C53B7.2NP_509154.2 TIL 29..82 CDD:460351 17/53 (32%)

Return to query results.
Submit another query.