DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34189 and C25E10.8

DIOPT Version :9

Sequence 1:NP_001097347.1 Gene:CG34189 / 5740826 FlyBaseID:FBgn0085218 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001370492.1 Gene:C25E10.8 / 182892 WormBaseID:WBGene00016097 Length:137 Species:Caenorhabditis elegans


Alignment Length:57 Identity:20/57 - (35%)
Similarity:24/57 - (42%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGENATMVRCAGVCPETCAFKSLK-CPKYCGVN-CVCKPDYVFNENLQLCILKTDCP 107
            |.||.|..||...|..||.....: |.:.|.|| |.|...:|  .|...|....:||
 Worm    82 CPENETFFRCGTACEPTCEKPGPRPCTRQCIVNVCQCSSGFV--RNGYRCTELKECP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34189NP_001097347.1 TIL 53..106 CDD:280072 18/54 (33%)
C25E10.8NP_001370492.1 TIL 21..75 CDD:418800
TIL 82..135 CDD:410995 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.