powered by:
Protein Alignment CG34189 and C25E10.7
DIOPT Version :9
Sequence 1: | NP_001097347.1 |
Gene: | CG34189 / 5740826 |
FlyBaseID: | FBgn0085218 |
Length: | 122 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505344.2 |
Gene: | C25E10.7 / 182891 |
WormBaseID: | WBGene00016096 |
Length: | 157 |
Species: | Caenorhabditis elegans |
Alignment Length: | 81 |
Identity: | 28/81 - (34%) |
Similarity: | 32/81 - (39%) |
Gaps: | 14/81 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 PFSGFCGENATMVRCAGVCPETCAFKSLKCPKYCGVN-CVCKPDYVFNENLQLCILKTDCPLDIK 111
||...||:|...|.|...|...|.|....|...|..| ||||..||.|.... |:.:.:|
Worm 25 PFLPECGKNQKRVACGYDCEPQCGFDPTVCSLECKPNACVCKDGYVRNTKND-CVRRLEC----- 83
Fly 112 QLVVETHR-----VFQ 122
..||.| |||
Worm 84 --TAETSRCPEDEVFQ 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.