DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Chl1

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:455 Identity:85/455 - (18%)
Similarity:139/455 - (30%) Gaps:153/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MTNLVTHVMMDEPRFAQPIPNV------TVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHR 90
            ::|....:...:|:...|...:      ||..|....|.|..|.|...::.|..:.         
  Rat   238 ISNQANSIKQRKPKLLLPPAQIGSASSKTVLKGDTLLLECFAEGLPTPQIEWSKLG--------- 293

  Fly    91 HVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGY-LQVVV--PPNILDIES 152
               |.:|:...|...:...|.:......|||.|.|..|.  ::.:..: ..|:|  ||.   .:.
  Rat   294 ---SELPKGRATIEIHEKTLKIENVSYQDRGNYRCTANN--LLGKASHDFHVIVEEPPR---WKK 350

  Fly   153 TPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADV-----LPLTKVSR 212
            .|.|.......|..:.|.|:|.|.|.|.||...   :.:|...    :..||     :..|.:..
  Rat   351 KPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNG---LPIENHP----FPGDVMFPREISFTNLQP 408

  Fly   213 NEMGAYLCIATNGVPPSVSKRIILD-VEFSPMIWVPNQ-----LVGAPSGTDVTIDCHTEAHPKA 271
            |....|.|.|:| :..::.....:| |:..|:|...|:     :|    |....:.|...|.|||
  Rat   409 NHTAVYQCEASN-IHGTILANANIDVVDVVPLIQTKNEENYETVV----GYSAFLHCEYFASPKA 468

  Fly   272 IIYW-VYNSVMVLPSKKYKTD-------------------------------------------- 291
            .:.| |.:....|...:|.|.                                            
  Rat   469 TVVWEVADETHPLEGGRYHTHENGTLEIERTTEEDAGSYSCWVDNTMGKAVITANLDIRNATKLR 533

  Fly   292 ----------------YTENSYRAHMK------------------------------LTIRNLQY 310
                            |.|:...:|:|                              |||.|:..
  Rat   534 VFPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGANLTISNISG 598

  Fly   311 GDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVG 375
            .|.|.|.|.::.:|..|.|..:|..:.:|..|             .|::.|.|.:.:..|..:.|
  Rat   599 EDQGIYSCSAQTALDSTSGKTQVTVLGVPDPP-------------RNLLLSERQNRSVRLSWEAG 650

  Fly   376  375
              Rat   651  650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 19/98 (19%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 1/6 (17%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 22/98 (22%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/8 (25%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 30/186 (16%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/4 (25%)
Ig strand E 295..305 CDD:409353 3/39 (8%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
Chl1XP_038964701.1 Ig 34..125 CDD:472250
Ig strand B 52..56 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 105..110 CDD:409353
Ig strand G 119..122 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432
Ig strand A 134..137 CDD:409432
Ig strand A' 139..143 CDD:409432
Ig strand B 146..154 CDD:409432
Ig strand C 161..167 CDD:409432
Ig strand C' 170..173 CDD:409432
Ig strand D 179..183 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..208 CDD:409432
Ig strand G 211..224 CDD:409432
Ig 261..343 CDD:472250 19/95 (20%)
Ig strand B 273..277 CDD:409353 1/3 (33%)
Ig strand C 286..290 CDD:409353 0/3 (0%)
Ig strand E 308..312 CDD:409353 1/3 (33%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 21/97 (22%)
Ig strand B 363..367 CDD:409367 0/3 (0%)
Ig strand C 376..380 CDD:409367 1/3 (33%)
Ig strand E 399..403 CDD:409367 0/3 (0%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 0/2 (0%)
Ig 447..524 CDD:472250 12/80 (15%)
Ig strand B 456..460 CDD:409353 0/3 (0%)
Ig strand C 469..473 CDD:409353 0/3 (0%)
Ig strand E 492..496 CDD:409353 0/3 (0%)
Ig strand F 506..511 CDD:409353 0/4 (0%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Ig 528..627 CDD:472250 16/98 (16%)
Ig strand B 547..551 CDD:409353 0/3 (0%)
Ig strand C 564..568 CDD:409353 0/3 (0%)
Ig strand E 589..593 CDD:409353 1/3 (33%)
Ig strand F 603..608 CDD:409353 2/4 (50%)
Ig strand G 616..619 CDD:409353 1/2 (50%)
FN3 <626..>867 CDD:442628 7/38 (18%)
FN3 627..716 CDD:238020 7/37 (19%)
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.