DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and si:ch211-57n23.4

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009292645.2 Gene:si:ch211-57n23.4 / 799595 ZFINID:ZDB-GENE-140106-153 Length:722 Species:Danio rerio


Alignment Length:429 Identity:101/429 - (23%)
Similarity:154/429 - (35%) Gaps:103/429 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAW--IHI------DRQMILTIHRHVISRIPRYS 100
            |:|.....:::|..|..|...|.|..:....:.|  .|:      ||..:|.:            
Zfish   122 PKFHTHPESMSVDDGGVARFQCQVNGIPEASITWEKDHVVLGTSDDRYTLLPM------------ 174

  Fly   101 ITYTDNTWLLHVNQAHQDDRGYYMCQVN--TNPMISQVGYLQVV--VP-----PNILDIESTPSS 156
                   .:|.:....:.|.|.|.|..:  .|...|...:|.|.  ||     |.||   |.|.:
Zfish   175 -------GILQITGVKKADAGIYRCVASNIANTRYSHEAHLNVTGGVPRTYKEPVIL---SGPQN 229

  Fly   157 VAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCI 221
            :.:..:|...:.|.|.|.|.|.:.|.|.||..|.||   .:.|.....|.::.||....|.|:|.
Zfish   230 LTITVHQTAILECIATGNPRPIVSWSRLDGRSIGVE---GIQVLGTGNLMISDVSLQHSGVYVCA 291

  Fly   222 ATNGVPPSVSKRIILD---VEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVL 283
            |..  |.:..:|..|.   |:..|......|.|..|:|......|..:..|:..|.|:.|..::.
Zfish   292 ANR--PGTRMRRTALGRLVVQAPPEFIQWPQSVSKPAGGSAVFTCVAQGVPEPHIIWLKNGKILT 354

  Fly   284 PSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRV-----YEIP-----L 338
            |....|  .|.|    :..|.:..:...|...|:||::|:.|..:.|.|:     .|:|     |
Zfish   355 PGDNVK--LTNN----NSTLAVTRITSEDEAIYQCIAENTAGTNQASARLAVSLAKELPDSPQGL 413

  Fly   339 PST-------------PSKQVTHTTV------------ESRENNIIPSS---RNDTTKSLQTDVG 375
            .:|             |..:||...:            ||:|.....|.   ::|.| :|:....
Zfish   414 KATALSKTSLQLSWTQPPAEVTDGIIGYVLHIRKYGESESKELQEAVSKTTFQHDLT-NLEPATT 477

  Fly   376 YAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGV 414
            |::....|           |...||..||...|...|||
Zfish   478 YSIYLKAY-----------SPLGASQQSSTVVSTTLGGV 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 19/103 (18%)
Ig 145..238 CDD:416386 29/95 (31%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/10 (20%)
Ig 242..333 CDD:416386 22/90 (24%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 3/13 (23%)
si:ch211-57n23.4XP_009292645.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.