DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and zgc:152904

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001070212.1 Gene:zgc:152904 / 767777 ZFINID:ZDB-GENE-060929-856 Length:809 Species:Danio rerio


Alignment Length:418 Identity:91/418 - (21%)
Similarity:162/418 - (38%) Gaps:49/418 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVNQA 115
            |.|..........||.......:|.|..         ..|.|....:|.: |.......|.|...
Zfish   188 NATADYQESVTFTCVTSGSPDPQVTWYW---------KGHAIEHSEQYVLNTMNGGKSTLTVKNI 243

  Fly   116 HQDDRGYYMCQVNTNPMISQVG-YLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKI 179
            .|.|.|.|||:.:.....|:.. :|:|.|.|:|..:.    :|...|.....::|.|:|.|.|:|
Zfish   244 KQTDGGPYMCRASNKAGSSESQLFLKVFVQPHITQLR----NVTAVEGSAAMISCTAEGEPLPEI 304

  Fly   180 IWRR-------EDGEEIAVEKKKKVLV---YDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRI 234
            .|||       .|||:   .|..:|.|   :...:|.::.|..::.|.:.|.|.:.: ....|.:
Zfish   305 SWRRASDGHSFTDGEK---SKDGRVEVRGRHGKSMLTISGVQLSDWGRFDCEALSRI-GGHQKSM 365

  Fly   235 ILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRA 299
            .||:|::|.......:..:..|..|.|.|..:::|.|.:.|......:  |.:..::...:|...
Zfish   366 FLDI
EYAPKFQTNQSIFYSWEGNPVNISCEVKSNPAATMLWRRERFTI--SSQGTSNIRIHSTDG 428

  Fly   300 HMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRN 364
            ...|.:..:...|||.|.|.::|::|.......:.:..:||:| ..|..|.|         |.|.
Zfish   429 RSLLEVTPVSDRDFGRYNCTARNNIGARYQEFILAQADVPSSP-YSVRMTAV---------SQRM 483

  Fly   365 DTTKSLQTD------VGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMG 423
            .|...::.|      :.:.:.|  |..::|:.....:.:....::.:.||..|.......:|::.
Zfish   484 ATVSFMKPDSHGGVPISFYIIN--YRDTSSAQEWRSARTHGVQTAVVLTSLEPNTTYEVRVSAVN 546

  Fly   424 SKGSLAIGKSTFYTERPPNEYAASSVAG 451
            .||......:..:...|..|.:..:|.|
Zfish   547 GKGQGEFSHTESFQTLPIREPSPPTVHG 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/92 (23%)
Ig 145..238 CDD:416386 26/102 (25%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 2/6 (33%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 18/90 (20%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
zgc:152904NP_001070212.1 Ig 1..81 CDD:299845
IG_like 2..80 CDD:214653
IGc2 97..158 CDD:197706
Ig 177..273 CDD:299845 21/93 (23%)
I-set 184..270 CDD:254352 20/90 (22%)
Ig 272..369 CDD:299845 27/104 (26%)
I-set 274..367 CDD:254352 25/100 (25%)
IG_like 385..462 CDD:214653 17/78 (22%)
IGc2 386..454 CDD:197706 16/69 (23%)
FN3 468..561 CDD:238020 19/104 (18%)
fn3 <591..650 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.