DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and ntm

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001003852.2 Gene:ntm / 678534 ZFINID:ZDB-GENE-060421-6020 Length:375 Species:Danio rerio


Alignment Length:361 Identity:95/361 - (26%)
Similarity:158/361 - (43%) Gaps:58/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NVTVAVGRDANLPC----VVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYS-ITYTDNTWLLH 111
            |:|:..|....|.|    .|.|     .||  ::|..||.......|..||.| :|.:...:.:.
Zfish    39 NITIRQGETLFLSCSQGDFVTH-----TAW--LNRSSILYAGEDKWSVDPRVSLVTLSQEEFTIK 96

  Fly   112 VNQAHQDDRGYYMCQVNTN--PMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGF 174
            :......|.|.|:|.|.|:  |..:.| ::.|.|||.|:::.   ..:.|.|..|:.:.|.|:|.
Zfish    97 IEDVDVTDEGQYICAVQTSSRPRTTSV-HIIVQVPPKIVNLS---RDLVVNEGSNVTLMCLANGK 157

  Fly   175 PAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVE 239
            |.|.|:||.:...:.::..       |::||.:..:||...|.|.|.|.|.:... ::.:.|.|.
Zfish   158 PEPAIVWRMKSPSDDSLSS-------DSEVLDIPFISRYRAGVYECTAANDIAVD-TQTVELTVN 214

  Fly   240 FSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW------VYNSVMVLPSKKYKTDYTE-NSY 297
            ::|.: ...:.||...|....:.|..:|.|:|...|      ::|.:          |..| .:.
Zfish   215 YAPSV-SDGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGL----------DGIEIEAA 268

  Fly   298 RAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSS 362
            .|..:||..|:...|:|||.|::.|.||....|..:|||..|::.:.....|:         ||.
Zfish   269 GALSRLTFFNVSEADYGNYTCVAINKLGSANTSFVLYEIIEPTSSTLLQVETS---------PSV 324

  Fly   363 RNDTTKSLQTDVGYAMKNDLY--PGSASSSSSGGSS 396
            ...|:..|:..   .::|||:  ||:....:||.|:
Zfish   325 LEMTSSDLEQT---PLQNDLWEGPGAVQDGNSGTST 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 26/97 (27%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 0/6 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 24/92 (26%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 25/97 (26%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/9 (11%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
ntmNP_001003852.2 Ig 39..127 CDD:472250 25/95 (26%)
Ig strand B 48..52 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 3/10 (30%)
Ig strand E 93..97 CDD:409353 0/3 (0%)
Ig strand F 107..112 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Ig_3 130..200 CDD:464046 23/79 (29%)
Ig 223..304 CDD:472250 24/90 (27%)
Ig strand B 233..237 CDD:409353 0/3 (0%)
Ig strand C 246..250 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.