| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038958934.1 | Gene: | Negr1 / 59318 | RGDID: | 708416 | Length: | 362 | Species: | Rattus norvegicus |
| Alignment Length: | 324 | Identity: | 94/324 - (29%) |
|---|---|---|---|
| Similarity: | 134/324 - (41%) | Gaps: | 39/324 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 IPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVN 113
Fly 114 QAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPA 176
Fly 177 PKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVP-PSVSK-RIILDVE 239
Fly 240 FSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW------VYNSVMVLPSKKYKTDYTENSYR 298
Fly 299 AHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSS 362 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 31/94 (33%) |
| Ig | 145..238 | CDD:416386 | 28/94 (30%) | ||
| Ig strand A | 145..149 | CDD:409353 | 2/3 (67%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 3/8 (38%) | ||
| Ig | 242..333 | CDD:416386 | 23/96 (24%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 272..277 | CDD:409353 | 1/10 (10%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
| Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) | ||
| Negr1 | XP_038958934.1 | FR1 | 38..55 | CDD:409353 | 5/15 (33%) |
| Ig strand A' | 40..46 | CDD:409353 | 2/5 (40%) | ||
| IG_like | 41..129 | CDD:214653 | 30/91 (33%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 61..68 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C | 61..67 | CDD:409353 | 3/7 (43%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 11/34 (32%) | ||
| Ig strand D | 84..91 | CDD:409353 | 4/6 (67%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 4/9 (44%) | ||
| FR4 | 122..129 | CDD:409353 | 3/7 (43%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 0/7 (0%) | ||
| IGc2 | 146..204 | CDD:197706 | 19/65 (29%) | ||
| Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 207..215 | CDD:409353 | 3/9 (33%) | ||
| Ig_3 | 219..295 | CDD:404760 | 18/85 (21%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 235..239 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I11853 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 142 | 1.000 | Inparanoid score | I4382 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm8971 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 7.970 | |||||