DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and CG34353

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:454 Identity:125/454 - (27%)
Similarity:189/454 - (41%) Gaps:91/454 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSRFTNRR------IMFL------IYMTNLVTHVMM--DEPRFAQPIPNVTVAVGRDANLPCVVE 68
            |....:||      |:||      ::..::....||  :||.|...........|....|||.|.
  Fly    46 PGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVA 110

  Fly    69 HLGGYKVAWIHIDRQM-ILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPM 132
            :...|.|||   .|.: |||.....::..||..:.   |.:.|.:..|...|.|.|:||:.|...
  Fly   111 NTDTYVVAW---KRGIAILTAGSVKVTPDPRVRLV---NGFNLQIRDALPTDAGDYICQIATMDP 169

  Fly   133 ISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRE-----DGEEIAVE 192
            ......::::|||.|..| ||...:.|::..::.:.|.|.|.|.|.:.|.|:     :|||    
  Fly   170 REITHTVEILVPPRIHHI-STGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEE---- 229

  Fly   193 KKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGT 257
                  ...:.||.:..|.|::.|.|:|.|.|.|....|.:::|.|.|||.|.|...:|.:..|.
  Fly   230 ------KLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGH 288

  Fly   258 DVTIDC--HTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCIS 320
            :.|:.|  |.|..|:.|  | :...|.|.:.:.....|..|...   |.||.:...|||||.|::
  Fly   289 EATLVCIVHGETQPEVI--W-FKDTMQLDTTERHIMETRGSRHT---LIIRKVHPQDFGNYSCVA 347

  Fly   321 KNSLGETEGSIRVYEIP----LPSTPSKQV-----------THTTVESRENNI--IPSSRNDTTK 368
            :|.||:...::::...|    ..|.|..|.           :|:.:|..:.:.  :|....    
  Fly   348 ENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGHE---- 408

  Fly   369 SLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSAL--------PGGVAGNSLSSMGS 424
                .||.|:           .||..|||.:||||.|..|.|        .||::|  ||..||
  Fly   409 ----VVGNAI-----------DSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSG--LSGSGS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 24/92 (26%)
Ig 145..238 CDD:416386 28/97 (29%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 28/92 (30%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 3/8 (38%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 1/1 (100%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/85 (28%)
Ig 103..177 CDD:143165 23/79 (29%)
IG_like 191..269 CDD:214653 23/87 (26%)
IGc2 198..258 CDD:197706 19/69 (28%)
I-set 273..360 CDD:254352 28/92 (30%)
Ig 290..359 CDD:143165 23/74 (31%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.