DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and igsf9bb

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio


Alignment Length:426 Identity:105/426 - (24%)
Similarity:153/426 - (35%) Gaps:84/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGG--YKVAWI-----------------HIDRQ 83
            |.:.:||:|.......||.:|.|     ||..|.|  |.|.|.                 |:|.:
Zfish    24 HGVREEPQFVTSRAGETVILGCD-----VVHPLNGQPYVVEWFKFGVPIPFFINFRFYPPHVDPE 83

  Fly    84 MILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQV---------GYL 139
            .......|..|.              |.:.:...:|:|:|.|:|   .|:.|.         .:|
Zfish    84 YAGRASLHGKSS--------------LRIERVRSEDQGWYECKV---LMLEQQYHTFHNGSWVHL 131

  Fly   140 QVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADV 204
            .|..||...|  :.|..|..:|..:|.::|.|.|.|.|.:.|.||..   .|:...|..|.|.. 
Zfish   132 TVNAPPTFTD--TPPQYVEAKEGGSITLSCTAFGNPKPSVSWLREGN---PVQDSTKYKVSDGS- 190

  Fly   205 LPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHP 269
            |.|..:||.:.|||.|.|.:....:|....:| |:..|.|..|.:.:......|....|..||:|
Zfish   191 LTLVSISREDRGAYTCRAYSEQGEAVHTTRLL-VQGPPFIVSPPENITVNISQDAFFTCQAEAYP 254

  Fly   270 KAIIY-WVYNSVMVLPSKKYKTDYTEN-SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGS-- 330
            ..:.| |.:....|.    :|.|.... |......|.|..::..|.|.|.|...||||....:  
Zfish   255 GNLTYTWFWEEDNVF----FKNDLKRRVSILIDGSLIISQVKPEDAGKYTCSPSNSLGRPPSASA 315

  Fly   331 -------IRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQ-TDVGYAMKNDLYPGSA 387
                   .||..:|       .|.:..:........|...|....|:: ...|..::.:.||| .
Zfish   316 YLTVHYPARVINMP-------PVIYVAIGLPGYIRCPVDANPPVTSVKWKKDGLPLRIEKYPG-W 372

  Fly   388 SSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMG 423
            |....|....:..:..|:.|...   |..|||.:||
Zfish   373 SQMEDGSIRVSEVTEDSLGTYTC---VPYNSLGTMG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 25/119 (21%)
Ig 145..238 CDD:416386 29/92 (32%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 24/101 (24%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 2/3 (67%)
Ig strand E 295..305 CDD:409353 2/10 (20%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 2/17 (12%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653 22/101 (22%)
Ig 41..113 CDD:143165 19/90 (21%)
IG_like 144..223 CDD:214653 27/83 (33%)
IGc2 151..208 CDD:197706 22/60 (37%)
I-set 227..319 CDD:254352 24/95 (25%)
Ig <263..319 CDD:299845 14/59 (24%)
Ig_2 326..414 CDD:290606 19/91 (21%)
IG_like 329..403 CDD:214653 17/84 (20%)
IG_like 424..504 CDD:214653
Ig 440..504 CDD:299845
FN3 509..604 CDD:238020
FN3 620..704 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.