DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and igsf9ba

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:438 Identity:110/438 - (25%)
Similarity:171/438 - (39%) Gaps:62/438 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HVMMDEPRFAQPIPNVTVAVGRDANLPCVVEH-LGG----YKVAWIHIDRQMILTIHRHVISRIP 97
            |.:.:||:|      ||...|....|.|.|.| |.|    |.|.|......:...|:.....  |
Zfish    24 HGVREEPQF------VTARAGESVVLGCDVSHPLNGQQTPYVVEWFKFGVPIPFFINFRFYP--P 80

  Fly    98 RYSITYTDNTWL-----LHVNQAHQDDRGYYMCQVNTNPMISQV---------GYLQVVVPPNIL 148
            .....|.....|     |.:.|...:|:|:|.|:|   .|:.|.         .:|.|..||...
Zfish    81 HVDPEYAGRASLHGKASLQIEQVRSEDQGWYECRV---LMLEQQYDTFHNGSWVHLTVNAPPTFS 142

  Fly   149 DIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRN 213
            |  :.|..|..||..:|.:||.|.|.|.|.:.|.|| |:::.  ..:|..|.|.. |.:..::|.
Zfish   143 D--TPPQYVEAREGGSITLTCTAFGNPKPVVTWLRE-GDQLT--STRKYTVSDGS-LTVQAITRE 201

  Fly   214 EMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIY-WVY 277
            :.|||.|.|.:....::....:| |:..|.|..|.:.:......:....|..||:|..:.| |.:
Zfish   202 DRGAYSCRAHSDQGEALHTTRLL-VQGPPYIVTPPENITVNISQNAQFTCQAEAYPGNLTYTWYW 265

  Fly   278 NSVMVLPSKKYKTDYTENSYRAHMK------LTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEI 336
            ....|         |.:|..:..::      |.|..::..|.|.|.|...||||.:..:.....:
Zfish   266 EEDNV---------YFKNDLKLRVRIFIDGTLIIYRVKPEDAGKYTCSPSNSLGISPSASAYLTV 321

  Fly   337 PLPSTPSKQVTHTTVESRENNII--PSSRNDTTKSLQTDV-GYAMKNDLYPGSASSSSSGGSSSA 398
            ..|:..........|..:.:.||  |...|....|::.:. ||.::.:.||| .|..:.|....|
Zfish   322 QYPARVVNMPPVIYVPRKLSGIIRCPVDANPPVTSVRWEKDGYPLRIEKYPG-WSQMTDGSIRVA 385

  Fly   399 ASSSSSMQTSALPGGVAGNSLSSMGSK--GSLAIGKSTFYTERPPNEY 444
            ..:..|:.|...   |..|.|.:||..  .:|.:....::..||..||
Zfish   386 EVTEDSLGTYTC---VPYNVLGTMGQSPPATLVLKDPPYFNVRPGGEY 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 27/110 (25%)
Ig 145..238 CDD:416386 28/92 (30%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 22/97 (23%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/15 (13%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 24/92 (26%)
I-set 139..225 CDD:254352 28/92 (30%)
I-set 229..321 CDD:333254 22/100 (22%)
Ig 345..415 CDD:325142 18/73 (25%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.